PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna32418.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 460aa    MW: 51579.7 Da    PI: 8.2035
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna32418.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.21.7e-1767110347
                              SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                               WT+ Ed+llvd+v+++ g +Wk Ia+ ++ gR++ qc++rwqk+
  mrna32418.1-v1.0-hybrid  67 CWTEKEDKLLVDLVRKFNGSNWKQIAAGIP-GRSDVQCQHRWQKV 110
                              6*****************************.************96 PP

2Myb_DNA-binding57.33.7e-18117162148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              +g WT eEd+ ++++v+++G + W+ Ia+ ++ gR +kqc++rw+++l
  mrna32418.1-v1.0-hybrid 117 KGYWTDEEDDCIIKLVEKYGAR-WSFIAKFLP-GRIGKQCRERWYNHL 162
                              689*******************.*********.*************97 PP

3Myb_DNA-binding50.35.7e-16168210145
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                              +++WT++E+  l+ +++q+G++ W+ I+r ++ gRt++ +k++w+
  mrna32418.1-v1.0-hybrid 168 KDAWTEDEERMLAFYHQQYGNK-WAEISRFLP-GRTDNAIKNHWN 210
                              679*******************.*********.***********7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.82560111IPR017930Myb domain
SuperFamilySSF466899.66E-1560117IPR009057Homeodomain-like
SMARTSM007171.0E-1364113IPR001005SANT/Myb domain
PfamPF002491.7E-1567110IPR001005SANT/Myb domain
CDDcd001674.51E-1368111No hitNo description
Gene3DG3DSA:1.10.10.603.2E-2168118IPR009057Homeodomain-like
PROSITE profilePS5129428.536112166IPR017930Myb domain
SuperFamilySSF466896.83E-30114209IPR009057Homeodomain-like
SMARTSM007178.6E-18116164IPR001005SANT/Myb domain
PfamPF002491.9E-17117162IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.7E-23119151IPR009057Homeodomain-like
CDDcd001672.08E-14120162No hitNo description
Gene3DG3DSA:1.10.10.604.0E-28152210IPR009057Homeodomain-like
SMARTSM007171.4E-13167215IPR001005SANT/Myb domain
PROSITE profilePS5129418.371167217IPR017930Myb domain
PfamPF002498.1E-14168210IPR001005SANT/Myb domain
CDDcd001675.89E-11170210No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 460 aa     Download sequence    Send to blast
MMKCPFGQVD LILLEIVVKV KREQMEEAVV HSDRTFGVLS EGNCESPVSE PSPRSWRTTG  60
PTRSSRCWTE KEDKLLVDLV RKFNGSNWKQ IAAGIPGRSD VQCQHRWQKV VNPEIIKGYW  120
TDEEDDCIIK LVEKYGARWS FIAKFLPGRI GKQCRERWYN HLSPAINKDA WTEDEERMLA  180
FYHQQYGNKW AEISRFLPGR TDNAIKNHWN GAFKRREDSY SPNGSECHMH TDNACSTELT  240
LGRSYGSEGD SVKAQKCKSS KRWPSGSINL HTTLQSDCSN VVTPLGVKIS GYCKQIADHT  300
VEDRPFPNSP LVFMDSSTST YSNCTPPKIQ YCYSTPPTNV QNVYASSTSP KSRLKSLART  360
FKNTPSIIRK RASRTADHTN SSGASCSTAF NILSLGEACI NSTYSNSSDY VRGLSSMRHR  420
HETSEAHKSL GRCLELEFDD ENDSGIANCG EVSSAYVGA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C4e-63602165158MYB PROTO-ONCOGENE PROTEIN
1h89_C4e-63602165158MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004300765.10.0PREDICTED: myb-related protein 306-like
TrEMBLM5WS751e-118M5WS75_PRUPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF133012528
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.25e-71myb domain protein 3r-4